Product Name |
1110067D22Rik Blocking Peptide |
Catalog No |
33R-1693 |
Size |
100 ug |
Price |
$ 175.00
|
Synonymns |
1110067D22Rik control peptide, 1110067D22Rik antibody Blocking Peptide, Anti-1110067D22Rik Blocking Peptide, RIKEN cDNA 1110067D22 gene Blocking Peptide, A530071M23 Blocking Peptide, Grpa Blocking Peptide, Hspc159 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of 1110067D22Rik antibody, catalog no. 70R-9298 |
Background |
1110067D22Rik does not bind lactose, and may not bind carbohydrates. |
Residues |
CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ |
Molecular Weight |
19 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
