Product Name |
2'-PDE antibody |
Catalog No |
70R-2362 |
Size |
50 ug |
Concentration |
1 mg/ml |
Price |
$ 375.00
|
Synonymns |
Polyclonal 2'-PDE antibody, Anti-2'-PDE antibody, Phosphodiesterase antibody |
Description |
Rabbit polyclonal 2'-PDE antibody raised against the middle region of 2'-Pde |
Background |
2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system. |
Immunogen |
2'-PDE antibody was raised using the middle region of 2'-Pde corresponding to a region with amino acids CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW |
Host |
Rabbit |
Specificity |
2'-PDE antibody was raised against the middle region of 2'-Pde |
Cross Reactivity |
Human,Mouse |
Method of Purification |
Affinity purified |
Form & Buffer |
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 2'-PDE antibody in PBS |
Storage |
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
Applications |
WB |
Usage Recommendations |
WB: 1 ug/ml |
Assay Information |
2'-PDE Blocking Peptide, catalog no. 33R-1734, is also available for use as a blocking control in assays to test for specificity of this 2'-PDE antibody |
Additional Information |
This is a rabbit polyclonal antibody against 2'-PDE, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com |
