Product Name |
2'-PDE Blocking Peptide |
Catalog No |
33R-1734 |
Size |
100 ug |
Price |
$ 175.00
|
Synonymns |
2'-PDE control peptide, 2'-PDE antibody Blocking Peptide, Anti-2'-PDE Blocking Peptide, Phosphodiesterase Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of 2'-PDE antibody, catalog no. 70R-2362 |
Background |
2'-PDE is an enzyme that cleaves 2',5'-phosphodiester bond linking adenosines of the 5'-triphosphorylated oligoadenylates, triphosphorylated oligoadenylates referred as 2-5A modulates the 2-5A system. This enzyme degraded triphosphorylated 2-5A to produce AMP and ATP. 2'-PDE also cleaves 3',5'-phosphodiester bond of oligoadenylates. 2'-PDE play a role as a negative regulator of the 2-5A system that is one of the major pathways for antiviral and antitumor functions induced by interferons (IFNs). Suppression of this enzyme induces reduction of viral replication in Hela cells, thus counteracting the antiviral pathway probably by inhibiting the 2-5A system. |
Residues |
CLDYIFIDLNALEVEQVIPLPSHEEVTTHQALPSVSHPSDHIALVCDLKW |
Molecular Weight |
67 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
