Product Name |
2010315L10RIK Blocking Peptide |
Catalog No |
33R-5721 |
Size |
100 ug |
Price |
$ 175.00
|
Synonymns |
2010315L10RIK control peptide, 2010315L10RIK antibody Blocking Peptide, Anti-2010315L10RIK Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of 2010315L10RIK antibody, catalog no. 20R-1147 |
Background |
2010315L10RIK has not been widely studied and its function is yet to be elucidated fully. |
Residues |
MAQAEGAYHRPLATSRLELNLVRLLCRCESMAAEKREPDEWRLEKYVGAL |
Molecular Weight |
30 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |