Product Name |
2610034B18Rik Blocking Peptide |
Catalog No |
33R-8285 |
Size |
100 ug |
Price |
$ 175.00
|
Synonymns |
2610034B18Rik control peptide, 2610034B18Rik antibody Blocking Peptide, Anti-2610034B18Rik Blocking Peptide, RIKEN cDNA 2610034B18 gene Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of 2610034B18Rik antibody, catalog no. 70R-9356 |
Background |
The function of this protein remains unknown. |
Residues |
RYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGD |
Molecular Weight |
25 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
