Product Name |
2810405K02Rik Blocking Peptide |
Catalog No |
33R-8566 |
Size |
100 ug |
Price |
$ 175.00
|
Synonymns |
2810405K02Rik control peptide, 2810405K02Rik antibody Blocking Peptide, Anti-2810405K02Rik Blocking Peptide, RIKEN cDNA 2810405K02 gene Blocking Peptide, AI836168 Blocking Peptide, PM/PGFS Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of 2810405K02Rik antibody, catalog no. 70R-9211 |
Background |
2810405K02Rik catalyzes the reduction of prostaglandin-ethanolamide H2 (prostamide H2) to prostamide F(2alpha) with NADPH as proton donor. It also be able to reduce prostaglandin H2 to prostaglandin F(2alpha). |
Residues |
SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS |
Molecular Weight |
22 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
