Product Name |
2810451A06Rik Blocking Peptide |
Catalog No |
33R-5495 |
Size |
100 ug |
Price |
$ 175.00
|
Synonymns |
2810451A06Rik control peptide, 2810451A06Rik antibody Blocking Peptide, Anti-2810451A06Rik Blocking Peptide, DnaJ, Hsp40 homolog, subfamily C, member 22 Blocking Peptide, 2810451A06Rik Blocking Peptide, AI506245 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of 2810451A06Rik antibody, catalog no. 70R-8839 |
Background |
The function of this protein remains unknown. |
Residues |
LVAAVGNQTSDFKNTLGAAFLTSPVFYGRPIAILPISLAASITAQKHRRY |
Molecular Weight |
38 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
