Product Name |
40787 Blocking Peptide |
Catalog No |
33R-2900 |
Size |
100 ug |
Price |
$ 175.00
|
Synonymns |
40787 control peptide, 40787 antibody Blocking Peptide, Anti-40787 Blocking Peptide, septin 1 Blocking Peptide, DIFF6 Blocking Peptide, LARP Blocking Peptide, MGC20394 Blocking Peptide, PNUTL3 Blocking Peptide, SEP1 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of SEPT1 antibody, catalog no. 70R-9926 |
Background |
This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease. |
Residues |
FGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFIS |
Molecular Weight |
42 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
