Product Name |
ABCG2 antibody |
Catalog No |
70R-1773 |
Size |
100 ug |
Concentration |
1 mg/ml |
Price |
$ 275.00
|
Synonyms |
Polyclonal ABCG2 antibody, Anti-ABCG2 antibody, White 2 antibody, MXR antibody, MXR1 antibody, ABC15 antibody, BMDP antibody, BCRP antibody, MGC102821 antibody, Atp-Binding Cassette Sub-Family G2 antibody, ABCP antibody, BCRP1 antibody, CDw338 antibody, EST157481 antibody, MRX antibody |
Description |
Rabbit polyclonal ABCG2 antibody |
Background |
ABCG2 is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. |
Immunogen |
ABCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGFLPCRKPVEKEILSNINGIMKPGLNAILGPTGGGKSSLLDVLAARKDP |
Host |
Rabbit |
Cross Reactivity |
Human,Mouse,Rat |
Method of Purification |
Total IgG Protein A purified |
Form & Buffer |
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ABCG2 antibody in PBS |
Storage |
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
Usage Recommendations |
WB: 2.5 ug/ml; IHC: 4-8 ug/ml |
Assay Information |
ABCG2 Blocking Peptide, catalog no. 33R-8455, is also available for use as a blocking control in assays to test for specificity of this ABCG2 antibody |
Additional Information |
This is a rabbit polyclonal antibody against ABCG2. It was validated on Western Blot and immunohistochemistry. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com |
