Product Name |
ABHD13 antibody |
Catalog No |
70R-6949 |
Size |
50 ug |
Concentration |
1 mg/ml |
Price |
$ 345.00
|
Synonyms |
Polyclonal ABHD13 antibody, Anti-ABHD13 antibody, bA153I24.2 antibody, MGC27058 antibody, FLJ14906 antibody, RP11-153I24.2 antibody, Abhydrolase Domain Containing 13 antibody, C13orf6 antibody, BEM46L1 antibody |
Description |
Rabbit polyclonal ABHD13 antibody raised against the N terminal of ABHD13 |
Background |
ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown. |
Immunogen |
ABHD13 antibody was raised using the N terminal of ABHD13 corresponding to a region with amino acids SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN |
Host |
Rabbit |
Specificity |
ABHD13 antibody was raised against the N terminal of ABHD13 |
Cross Reactivity |
Human |
Method of Purification |
Affinity purified |
Form & Buffer |
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABHD13 antibody in PBS |
Storage |
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
Applications |
WB |
Usage Recommendations |
WB: 1 ug/ml |
Assay Information |
ABHD13 Blocking Peptide, catalog no. 33R-8762, is also available for use as a blocking control in assays to test for specificity of this ABHD13 antibody |
Additional Information |
This is a rabbit polyclonal antibody against ABHD13, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com |
