Product Name |
ABHD13 Blocking Peptide |
Catalog No |
33R-8762 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
ABHD13 control peptide, ABHD13 antibody Blocking Peptide, Anti-ABHD13 Blocking Peptide, Abhydrolase Domain Containing 13 Blocking Peptide, BEM46L1 Blocking Peptide, C13orf6 Blocking Peptide, FLJ14906 Blocking Peptide, MGC27058 Blocking Peptide, RP11-153I24.2 Blocking Peptide, bA153I24.2 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of ABHD13 antibody, catalog no. 70R-6949 |
Background |
ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown. |
Residues |
SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN |
Molecular Weight |
38 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
