Product Name |
ACTN2 Blocking Peptide |
Catalog No |
33R-4126 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
ACTN2 control peptide, ACTN2 antibody Blocking Peptide, Anti-ACTN2 Blocking Peptide, ACTN2, ACTN-2, ACTN 2, ACTN-2 Blocking Peptide, ACTN 2 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of ACTN2 antibody, catalog no. 20R-1159 |
Background |
The alpha-actinins are a multigene family of four actin-binding proteins related to dystrophin. The two skeletal muscle isoforms of alpha-actinin (ACTN2 and ACTN3) are major structural components of the Z-line involved in anchoring the actin-containing thin filaments. In humans, ACTN2 is expressed in all muscle fibres, while ACTN3 expression is restricted to a subset of type 2 fibres. Murine Actn2 and Actn3 are differentially expressed, spatially and temporally, during embryonic development and, in contrast to humans, alpha-actinin-2 expression does not completely overlap alpha-actinin-3 in postnatal skeletal muscle, suggesting independent function. |
Residues |
IQSYSIRISSSNPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHAN |
Molecular Weight |
98 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |