Product Name |
ADAMTS6 Blocking Peptide |
Catalog No |
33R-7435 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
ADAMTS6 control peptide, ADAMTS6 antibody Blocking Peptide, Anti-ADAMTS6 Blocking Peptide, ADAM metallopeptidase with thrombospondin type 1 motif, 6 Blocking Peptide, ADAM-TS6 Blocking Peptide, ADAMTS6, ADAMTS-6, ADAMTS 6, ADAMTS-6 Blocking Peptide, ADAMTS 6 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of ADAMTS6 antibody, catalog no. 70R-10203 |
Background |
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. |
Residues |
PWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTE |
Molecular Weight |
96 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
