Product Name |
ADRB2 Blocking Peptide |
Catalog No |
33R-9082 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
ADRB2 control peptide, ADRB2 antibody Blocking Peptide, Anti-ADRB2 Blocking Peptide, adrenergic, beta-2-, receptor, surface Blocking Peptide, ADRB2R Blocking Peptide, ADRBR Blocking Peptide, B2AR Blocking Peptide, BAR Blocking Peptide, BETA2AR Blocking Peptide, ADRB2, ADRB-2, ADRB 2, ADRB-2 Blocking Peptide, ADRB 2 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of ADRB2 antibody, catalog no. 70R-10424 |
Background |
This protein is beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. This receptor-channel complex also contains a G protein, an adenylyl cyclase, cAMP-dependent kinase, and the counterbalancing phosphatase, PP2A. The assembly of the signaling complex provides a mechanism that ensures specific and rapid signaling by this G protein-coupled receptor. This gene encodes beta-2-adrenergic receptor which is a member of the G protein-coupled receptor superfamily. This receptor is directly associated with one of its ultimate effectors, the class C L-type calcium channel Ca(V)1.2. |
Residues |
TGEQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTN |
Molecular Weight |
46 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
