Product Name |
AHNAK2 antibody |
Catalog No |
70R-3905 |
Size |
50 ug |
Concentration |
1 mg/ml |
Price |
$ 345.00
|
Synonyms |
Polyclonal AHNAK2 antibody, Anti-AHNAK2 antibody, Ahnak Nucleoprotein 2 antibody |
Description |
Rabbit polyclonal AHNAK2 antibody raised against the middle region of AHNAK2 |
Background |
The specific function of AHNAK2 is not yet known. |
Immunogen |
AHNAK2 antibody was raised using the middle region of AHNAK2 corresponding to a region with amino acids AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP |
Host |
Rabbit |
Specificity |
AHNAK2 antibody was raised against the middle region of AHNAK2 |
Cross Reactivity |
Human |
Method of Purification |
Affinity purified |
Form & Buffer |
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AHNAK2 antibody in PBS |
Storage |
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
Applications |
WB |
Usage Recommendations |
WB: 1 ug/ml |
Assay Information |
AHNAK2 Blocking Peptide, catalog no. 33R-1056, is also available for use as a blocking control in assays to test for specificity of this AHNAK2 antibody |
Additional Information |
This is a rabbit polyclonal antibody against AHNAK2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com |