*Not able to read?
click here to refresh

  
We will respond to your inquiry within 1-2 working days.

AHNAK2 antibody (70R-3905)

Rabbit polyclonal AHNAK2 antibody raised against the middle region of AHNAK2

printer
Buy Now
Product Name
AHNAK2 antibody
Catalog No
70R-3905
Size
50 ug
Concentration
1 mg/ml
Price
$345.00
Synonyms
Polyclonal AHNAK2 antibody, Anti-AHNAK2 antibody, Ahnak Nucleoprotein 2 antibody
Description
Rabbit polyclonal AHNAK2 antibody raised against the middle region of AHNAK2
Background
The specific function of AHNAK2 is not yet known.
Immunogen
AHNAK2 antibody was raised using the middle region of AHNAK2 corresponding to a region with amino acids AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP
Host
Rabbit
Specificity
AHNAK2 antibody was raised against the middle region of AHNAK2
Cross Reactivity
Human
Molecular Weight
85 kDa (MW of target protein)
Method of Purification
Affinity purified
Form & Buffer
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AHNAK2 antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Applications
WB
Usage Recommendations
WB: 1 ug/ml
Assay Information
AHNAK2 Blocking Peptide, catalog no. 33R-1056, is also available for use as a blocking control in assays to test for specificity of this AHNAK2 antibody
Additional Information
This is a rabbit polyclonal antibody against AHNAK2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
 
Western Blot analysis using AHNAK2 antibody (70R-3905)
AHNAK2 antibody Images:
Western Blot analysis using AHNAK2 antibody (70R-3905)
AHNAK2 antibody (70R-3905) used at 1 ug/ml to detect target protein.