Product Name |
AHNAK2 Blocking Peptide |
Catalog No |
33R-1056 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
AHNAK2 control peptide, AHNAK2 antibody Blocking Peptide, Anti-AHNAK2 Blocking Peptide, Ahnak Nucleoprotein 2 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of AHNAK2 antibody, catalog no. 70R-3905 |
Background |
The specific function of AHNAK2 is not yet known. |
Residues |
AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP |
Molecular Weight |
85 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
