*Not able to read?
click here to refresh

  
We will respond to your inquiry within 1-2 working days.

AHNAK2 Blocking Peptide (33R-1056)

A synthetic peptide for use as a blocking control in assays to test for specificity of AHNAK2 antibody, catalog no. 70R-3905

printer
Buy Now
Product Name
AHNAK2 Blocking Peptide
Catalog No
33R-1056
Size
100 ug
Price
$130.00
Synonyms
AHNAK2 control peptide, AHNAK2 antibody Blocking Peptide, Anti-AHNAK2 Blocking Peptide, Ahnak Nucleoprotein 2 Blocking Peptide
Description
A synthetic peptide for use as a blocking control in assays to test for specificity of AHNAK2 antibody, catalog no. 70R-3905
Background
The specific function of AHNAK2 is not yet known.
Residues
AATRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIP
Molecular Weight
85 kDa
Protein Type
Synthetic
Form & Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Applications
IHC, WB