Product Name |
AIFM3 Blocking Peptide |
Catalog No |
33R-2429 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
AIFM3 control peptide, AIFM3 antibody Blocking Peptide, Anti-AIFM3 Blocking Peptide, Cell Cycle & Cell Death-Inducing Factor Mitochondrion-Associated 3 Blocking Peptide, AIFL Blocking Peptide, FLJ30473 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of AIFM3 antibody, catalog no. 70R-2470 |
Background |
AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential. |
Residues |
EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL |
Molecular Weight |
67 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
