*Not able to read?
click here to refresh

  
We will respond to your inquiry within 1-2 working days.

AIFM3 Blocking Peptide (33R-2429)

A synthetic peptide for use as a blocking control in assays to test for specificity of AIFM3 antibody, catalog no. 70R-2470

printer
Buy Now
Product Name
AIFM3 Blocking Peptide
Catalog No
33R-2429
Size
100 ug
Price
$130.00
Synonyms
AIFM3 control peptide, AIFM3 antibody Blocking Peptide, Anti-AIFM3 Blocking Peptide, Cell Cycle & Cell Death-Inducing Factor Mitochondrion-Associated 3 Blocking Peptide, AIFL Blocking Peptide, FLJ30473 Blocking Peptide
Description
A synthetic peptide for use as a blocking control in assays to test for specificity of AIFM3 antibody, catalog no. 70R-2470
Background
AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.
Residues
EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
Molecular Weight
67 kDa
Protein Type
Synthetic
Form & Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Applications
IHC, WB