Product Name |
AIM2 Blocking Peptide |
Catalog No |
33R-2734 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
AIM2 control peptide, AIM2 antibody Blocking Peptide, Anti-AIM2 Blocking Peptide, absent in melanoma 2 Blocking Peptide, PYHIN4 Blocking Peptide, AIM2, AIM-2, AIM 2, AIM-2 Blocking Peptide, AIM 2 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of AIM2 antibody, catalog no. 70R-8915 |
Background |
AIM2 is a member of the IFI20X /IFI16 family. It plays a putative role in tumorigenic reversion and may control cell proliferation. Interferon-gamma induces expression of AIM2.AIM2 is a member of the IFI20X /IFI16 family. It plays a putative role in tumorigenic reversion and may control cell proliferation. Interferon-gamma induces expression of AIM2. |
Residues |
ESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVATL |
Molecular Weight |
39 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
