Product Name |
AKAP8 Blocking Peptide |
Catalog No |
33R-1721 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
AKAP8 control peptide, AKAP8 antibody Blocking Peptide, Anti-AKAP8 Blocking Peptide, A kinase, PRKA anchor protein 8 Blocking Peptide, AKAP95 Blocking Peptide, DKFZp586B1222 Blocking Peptide, AKAP8, AKAP-8, AKAP 8, AKAP-8 Blocking Peptide, AKAP 8 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP8 antibody, catalog no. 70R-7946 |
Background |
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP8 is a member of the AKAP family. It is located in the nucleus during interphase and is distinctly redistributed during mitosis. This protein has a cell cycle-dependent interaction with the RII subunit of PKA. |
Residues |
CKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKI |
Molecular Weight |
76 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
