*Not able to read?
click here to refresh

  
We will respond to your inquiry within 1-2 working days.

AKAP8 Blocking Peptide (33R-1721)

A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP8 antibody, catalog no. 70R-7946

printer
Buy Now
Product Name
AKAP8 Blocking Peptide
Catalog No
33R-1721
Size
100 ug
Price
$130.00
Synonyms
AKAP8 control peptide, AKAP8 antibody Blocking Peptide, Anti-AKAP8 Blocking Peptide, A kinase, PRKA anchor protein 8 Blocking Peptide, AKAP95 Blocking Peptide, DKFZp586B1222 Blocking Peptide, AKAP8, AKAP-8, AKAP 8, AKAP-8 Blocking Peptide, AKAP 8 Blocking Peptide
Description
A synthetic peptide for use as a blocking control in assays to test for specificity of AKAP8 antibody, catalog no. 70R-7946
Background
The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. AKAP8 is a member of the AKAP family. It is located in the nucleus during interphase and is distinctly redistributed during mitosis. This protein has a cell cycle-dependent interaction with the RII subunit of PKA.
Residues
CKFRSFDDEEIQKHLQSKFHKETLRFISTKLPDKTVEFLQEYIVNRNKKI
Molecular Weight
76 kDa
Protein Type
Synthetic
Form & Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
Applications
IHC, WB