Product Name |
ASCC2 Blocking Peptide |
Catalog No |
33R-10082 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
ASCC2 control peptide, ASCC2 antibody Blocking Peptide, Anti-ASCC2 Blocking Peptide, Activating Signal Cointegrator 1 Complex Subunit 2 Blocking Peptide, ASC1p100 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of ASCC2 antibody, catalog no. 70R-3373 |
Background |
ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation. |
Residues |
YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTKVPREGQEEDD |
Molecular Weight |
86 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
