*Not able to read?
click here to refresh

  
We will respond to your inquiry within 1-2 working days.

Beta Lactamase antibody (70R-2442)

Rabbit polyclonal Beta Lactamase antibody raised against the C terminal of LACTB

printer
Buy Now
Product Name
Beta Lactamase antibody
Catalog No
70R-2442
Size
50 ug
Concentration
1 mg/ml
Price
$345.00
Synonyms
Polyclonal Beta Lactamase antibody, Anti-Beta Lactamase antibody, FLJ14902 antibody, LACTB antibody, G24 antibody, Lactamase Beta antibody, MRPL56 antibody
Description
Rabbit polyclonal Beta Lactamase antibody raised against the C terminal of LACTB
Background
LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.
Immunogen
Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL
Host
Rabbit
Specificity
Beta Lactamase antibody was raised against the C terminal of LACTB
Cross Reactivity
Human,Mouse,Rat
Molecular Weight
61 kDa (MW of target protein)
Method of Purification
Affinity purified
Form & Buffer
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LACTB antibody in PBS
Storage
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Applications
WB
Usage Recommendations
WB: 0.5 ug/ml
Assay Information
Beta Lactamase Blocking Peptide, catalog no. 33R-9050, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody
Additional Information
This is a rabbit polyclonal antibody against LACTB, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
 
Western Blot analysis using Beta Lactamase antibody (70R-2442)
Beta Lactamase antibody Images:
Western Blot analysis using Beta Lactamase antibody (70R-2442)
Beta Lactamase antibody (70R-2442) used at 0.5 ug/ml to detect target protein.