Product Name |
CDK5 Blocking Peptide |
Catalog No |
33R-6331 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
CDK5 control peptide, CDK5 antibody Blocking Peptide, Anti-CDK5 Blocking Peptide, cyclin-dependent kinase 5 Blocking Peptide, CDK5, CDK-5, CDK 5, CDK-5 Blocking Peptide, CDK 5 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of CDK5 antibody, catalog no. 20R-1201 |
Background |
CDK5 is probably involved in the control of the cell cycle. CDK5 can interact with d1 and d3-type G1 cyclins and phosphorylate histone H1, tau, MAP2 and NF-H and NF-M. CDK5 can also interacts with p35 which activates the kinase |
Residues |
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALR |
Molecular Weight |
33 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
