Product Name |
ZP4 antibody |
Catalog No |
70R-7191 |
Size |
50 ug |
Concentration |
1 mg/ml |
Price |
$ 345.00
|
Synonyms |
Polyclonal ZP4 antibody, Anti-ZP4 antibody, ZP 4, Zona Pellucida Glycoprotein 4 antibody, ZP4, ZP-4, ZP1 antibody, ZBP antibody, ZPB antibody, ZP 4 antibody, ZP-4 antibody |
Description |
Rabbit polyclonal ZP4 antibody raised against the N terminal of ZP4 |
Background |
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. |
Immunogen |
ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT |
Host |
Rabbit |
Specificity |
ZP4 antibody was raised against the N terminal of ZP4 |
Cross Reactivity |
Human |
Method of Purification |
Affinity purified |
Form & Buffer |
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZP4 antibody in PBS |
Storage |
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
Applications |
WB |
Usage Recommendations |
WB: 0.5 ug/ml |
Assay Information |
ZP4 Blocking Peptide, catalog no. 33R-6616, is also available for use as a blocking control in assays to test for specificity of this ZP4 antibody |
Additional Information |
This is a rabbit polyclonal antibody against ZP4, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com |
