Product Name |
ZNF550 Blocking Peptide |
Catalog No |
33R-1823 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
ZNF550 control peptide, ZNF550 antibody Blocking Peptide, Anti-ZNF550 Blocking Peptide, zinc finger protein 550 Blocking Peptide, ZNF550, ZNF-550, ZNF 550, ZNF-550 Blocking Peptide, ZNF 550 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF550 antibody, catalog no. 20R-1242 |
Background |
ZNF550 contains 1 KRAB domain and 8 C2H2-type zinc fingers. ZNF550 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Residues |
CTQCGKAFHRSTYLIQHSVIHTGEMPYKCIECGKAFKRRSHLLQHQRVHT |
Molecular Weight |
42 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
