Product Name |
ZP1 antibody |
Catalog No |
70R-7060 |
Size |
50 ug |
Concentration |
1 mg/ml |
Price |
$ 375.00
|
Synonyms |
Polyclonal ZP1 antibody, Anti-ZP1 antibody, ZP1, ZP-1 antibody, ZP-1, Zona Pellucida Glycoprotein 1 antibody, ZP 1, ZP 1 antibody, Sperm Receptor antibody, MGC87693 antibody |
Description |
Rabbit polyclonal ZP1 antibody |
Background |
The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida. |
Immunogen |
ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN |
Host |
Rabbit |
Cross Reactivity |
Human |
Method of Purification |
Affinity purified |
Form & Buffer |
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZP1 antibody in PBS |
Storage |
Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
Applications |
WB |
Usage Recommendations |
WB: 1 ug/ml |
Assay Information |
ZP1 Blocking Peptide, catalog no. 33R-9168, is also available for use as a blocking control in assays to test for specificity of this ZP1 antibody |
Additional Information |
This is a rabbit polyclonal antibody against ZP1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com |
