Product Name |
ZP1 Blocking Peptide |
Catalog No |
33R-9168 |
Size |
100 ug |
Price |
$ 175.00
|
Synonyms |
ZP1 control peptide, ZP1 antibody Blocking Peptide, Anti-ZP1 Blocking Peptide, Zona Pellucida Glycoprotein 1 Blocking Peptide, Sperm Receptor Blocking Peptide, MGC87693 Blocking Peptide, ZP1, ZP-1, ZP 1, ZP-1 Blocking Peptide, ZP 1 Blocking Peptide |
Description |
A synthetic peptide for use as a blocking control in assays to test for specificity of ZP1 antibody, catalog no. 70R-7060 |
Background |
The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida. |
Residues |
TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN |
Molecular Weight |
70 kDa |
Protein Type |
Synthetic |
.
Form & Buffer |
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage |
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
Applications |
IHC, WB |
