A1BG antibody (70R-1579)

Rabbit polyclonal A1BG antibody raised against the N terminal of A1BG

Synonyms Polyclonal A1BG antibody, Anti-A1BG antibody, ABG-1, ABG 1 antibody, ABG-1 antibody, HYST2477 antibody, Alpha-1-B Glycoprotein antibody, ABG 1, ABG antibody, A1B antibody, DKFZp686F0970 antibody, GAB antibody, A1BG
Specificity A1BG antibody was raised against the N terminal of A1BG
Cross Reactivity Human
Applications WB
Immunogen A1BG antibody was raised using the N terminal of A1BG corresponding to a region with amino acids ITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPG
Assay Information A1BG Blocking Peptide, catalog no. 33R-4184, is also available for use as a blocking control in assays to test for specificity of this A1BG antibody

Images

A1BGModification Sites and Domains

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of A1BG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Product Use Purified polyclonal A1BG antibody specific for Human A1BG for use in Western blot
Biological Significance A1BG is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Expression 1BG is expressed at high levels in the adult and fetal liver. Additionally, the mammary gland shows roughly half as much expression as the liver.Trace amounts of A1BG expression can be found in the blood, brain, lung, lymph node, ovary, testis, pancreas, and pancreas. Liver tumors exhibit elevated levels of A1BG transcripts. A1BG is secreted mainly in the plasma membrane and endoplasmic reticulum of mammalian cells.
Implications in Disease Patients who have pancreatic ductal adenocarcinoma show an overexpression of A1BG in pancreatic juice. A1BG is upregulated 11-fold in the urine of patients who have steroid resistant nephrotic syndrome. A1BG was present in 7/19 patients with SRNS and was absent from all patients with steroid sensitive nephrotic syndrome. The 13.8 kDa A1BG fragment had a high discriminatory power for steroid resistance in pediatric nephrotic syndrome, but is only present in a subset of patients.
Sequence Information A1BG is located on the negative DNA strand of chromosome 19 from 58,858,172–58,864,865. Additionally, A1BG is located directly adjacent to the ZSCAN22 gene (58,838,385-58,853,712)) on the positive DNA strand, as well as the ZNF837 (58,878,990-58,892,389, complement) and ZNF497 (58865723-58,874,214, complement) genes on the negative strand.
Post-Translational Modifications A1BG undergoes glycosylation at Asn44, Asn179, Asn363, Asn371.
Database Links Entrez Gene: 1 Human, Omim: 138670 Human, SwissProt: P04217 Human, Unigene: 529161 Human

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • A1BGModification Sites and Domains
  • Western Blot analysis using A1BG antibody (70R-1579) | Western Blot showing A1BG antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors