A1BG antibody (70R-5403)

Rabbit polyclonal A1BG antibody raised against the N terminal of A1BG

Synonyms Polyclonal A1BG antibody, Anti-A1BG antibody, A1B antibody, ABG antibody, DKFZp686F0970 antibody, Alpha-1-B Glycoprotein antibody, GAB antibody, ABG 1 antibody, ABG-1, ABG-1 antibody, HYST2477 antibody, ABG 1, A1BG
Specificity A1BG antibody was raised against the N terminal of A1BG
Cross Reactivity Human
Applications WB
Immunogen A1BG antibody was raised using the N terminal of A1BG corresponding to a region with amino acids MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVPEAQEDVEATF

Images

Western Blot analysis using A1BG antibody (70R-5403)

Western Blot showing A1BG antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of A1BG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance A1BG is a plasma glycoprotein of unknown function. It shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using A1BG antibody (70R-5403) | Western Blot showing A1BG antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors