A1CF antibody (70R-4770)

Rabbit polyclonal A1CF antibody raised against the N terminal of A1CF

Synonyms Polyclonal A1CF antibody, Anti-A1CF antibody, APOBEC1CF antibody, ACF65 antibody, ACF 1, ACF-1 antibody, Apobec1 Complementation Factor antibody, MGC163391 antibody, RP11-564C4.2 antibody, A1CF, ACF64 antibody, ACF 1 antibody, ASP antibody, ACF-1, ACF antibody
Specificity A1CF antibody was raised against the N terminal of A1CF
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen A1CF antibody was raised using the N terminal of A1CF corresponding to a region with amino acids MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAA
Assay Information A1CF Blocking Peptide, catalog no. 33R-5962, is also available for use as a blocking control in assays to test for specificity of this A1CF antibody


Western Blot analysis using A1CF antibody (70R-4770)

A1CF antibody (70R-4770) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of A1CF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using A1CF antibody (70R-4770) | A1CF antibody (70R-4770) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors