A4GNT antibody (70R-7409)

Rabbit polyclonal A4GNT antibody raised against the C terminal of A4GNT

Synonyms Polyclonal A4GNT antibody, Anti-A4GNT antibody, AGNT 4 antibody, MGC149493 antibody, AGNT 4, alpha4GnT antibody, Alpha-14-N-Acetylglucosaminyltransferase antibody, AGNT-4, AGNT-4 antibody, A4GNT
Specificity A4GNT antibody was raised against the C terminal of A4GNT
Cross Reactivity Human
Applications WB
Immunogen A4GNT antibody was raised using the C terminal of A4GNT corresponding to a region with amino acids NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV
Assay Information A4GNT Blocking Peptide, catalog no. 33R-6732, is also available for use as a blocking control in assays to test for specificity of this A4GNT antibody

Images

Western Blot analysis using A4GNT antibody (70R-7409)

A4GNT antibody (70R-7409) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of A4GNT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance A4GNT is a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of N-acetylglucosamine (GlcNAc) to core 2 branched O-glycans. It forms a unique glycan, GlcNAcalpha1-->4Galbeta-->R and is largely associated with the Golgi apparatus membrane.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using A4GNT antibody (70R-7409) | A4GNT antibody (70R-7409) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors