AADACL4 antibody (70R-6671)

Rabbit polyclonal AADACL4 antibody raised against the N terminal of AADACL4

Synonyms Polyclonal AADACL4 antibody, Anti-AADACL4 antibody, Arylacetamide Deacetylase-Like 4 antibody
Specificity AADACL4 antibody was raised against the N terminal of AADACL4
Cross Reactivity Human
Applications WB
Immunogen AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHG
Assay Information AADACL4 Blocking Peptide, catalog no. 33R-2935, is also available for use as a blocking control in assays to test for specificity of this AADACL4 antibody


Western Blot analysis using AADACL4 antibody (70R-6671)

AADACL4 antibody (70R-6671) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AADACL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of AADAC protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using AADACL4 antibody (70R-6671) | AADACL4 antibody (70R-6671) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors