AARS antibody (70R-4640)

Rabbit polyclonal AARS antibody raised against the C terminal of AARS

Synonyms Polyclonal AARS antibody, Anti-AARS antibody, Alanyl-tRNA Synthetase antibody
Specificity AARS antibody was raised against the C terminal of AARS
Cross Reactivity Human,Mouse
Applications WB
Immunogen AARS antibody was raised using the C terminal of AARS corresponding to a region with amino acids VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT
Assay Information AARS Blocking Peptide, catalog no. 33R-9844, is also available for use as a blocking control in assays to test for specificity of this AARS antibody

Images

Western Blot analysis using AARS antibody (70R-4640)

AARS antibody (70R-4640) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 107 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AARS antibody (70R-4640) | AARS antibody (70R-4640) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors