ABCA12 antibody (70R-7156)

Rabbit polyclonal ABCA12 antibody

Synonyms Polyclonal ABCA12 antibody, Anti-ABCA12 antibody, ABCA12, ABCA 12 antibody, LI2 antibody, ABCA-12 antibody, ICR2B antibody, Atp-Binding Cassette Sub-Family A12 antibody, ABCA 12, ABCA-12, Abc1-12 antibody, DKFZp434G232 antibody, FLJ41584 antibody
Cross Reactivity Human
Applications WB
Immunogen ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV
Assay Information ABCA12 Blocking Peptide, catalog no. 33R-9318, is also available for use as a blocking control in assays to test for specificity of this ABCA12 antibody

Images

Western Blot analysis using ABCA12 antibody (70R-7156)

ABCA12 antibody (70R-7156) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 257 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCA12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABCA12 antibody (70R-7156) | ABCA12 antibody (70R-7156) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors