ABCB4 antibody (70R-6710)

Rabbit polyclonal ABCB4 antibody

Synonyms Polyclonal ABCB4 antibody, Anti-ABCB4 antibody, ABCB-4, Mdr/Tap 4 antibody, GBD1 antibody, MDR2 antibody, Atp-Binding Cassette Sub-Family B4 antibody, MDR3 antibody, ABCB-4 antibody, ABCB 4, MDR2/3 antibody, PGY3 antibody, ABCB 4 antibody, PFIC-3 antibody, ABCB4, ABC21 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM
Assay Information ABCB4 Blocking Peptide, catalog no. 33R-1187, is also available for use as a blocking control in assays to test for specificity of this ABCB4 antibody

Images

Western blot analysis using ABCB4 antibody (70R-6710)

Recommended ABCB4 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCB4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using ABCB4 antibody (70R-6710) | Recommended ABCB4 Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using ABCB4 antibody (70R-6710) | Tissue analyzed: 293T Whole Cell Lane A: Primary Antibody Lane B:Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 1ug/ml; Peptide Concentration: 5ug/ml Lysate Quantity: 25ug/lane/Lane Gel Concentration: 0.12

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors