ABCB4 antibody (70R-6711)

Rabbit polyclonal ABCB4 antibody

Synonyms Polyclonal ABCB4 antibody, Anti-ABCB4 antibody, ABC21 antibody, Atp-Binding Cassette Sub-Family B4 antibody, Mdr/Tap 4 antibody, GBD1 antibody, MDR2/3 antibody, MDR2 antibody, ABCB 4, ABCB4, PGY3 antibody, ABCB-4 antibody, ABCB 4 antibody, ABCB-4, PFIC-3 antibody, MDR3 antibody
Cross Reactivity Human
Applications WB
Immunogen ABCB4 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV
Assay Information ABCB4 Blocking Peptide, catalog no. 33R-3542, is also available for use as a blocking control in assays to test for specificity of this ABCB4 antibody

Images

Western Blot analysis using ABCB4 antibody (70R-6711)

ABCB4 antibody (70R-6711) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 141 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCB4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABCB4 antibody (70R-6711) | ABCB4 antibody (70R-6711) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors