ABCB9 antibody (70R-7349)

Rabbit polyclonal ABCB9 antibody

Synonyms Polyclonal ABCB9 antibody, Anti-ABCB9 antibody, ABCB 9, ABCB-9, TAPL antibody, KIAA1520 antibody, Mdr/Tap 9 antibody, Atp-Binding Cassette Sub-Family B9 antibody, EST122234 antibody, ABCB 9 antibody, ABCB-9 antibody, ABCB9
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ABCB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW
Assay Information ABCB9 Blocking Peptide, catalog no. 33R-8059, is also available for use as a blocking control in assays to test for specificity of this ABCB9 antibody

Images

Western Blot analysis using ABCB9 antibody (70R-7349)

ABCB9 antibody (70R-7349) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCB9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABCB9, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABCB9 is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. The function of this half-transporter has not yet been determined; however, this protein may play a role in lysosomes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABCB9 antibody (70R-7349) | ABCB9 antibody (70R-7349) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors