ABCC1 antibody (70R-6981)

Rabbit polyclonal ABCC1 antibody

Synonyms Polyclonal ABCC1 antibody, Anti-ABCC1 antibody, GS-X antibody, MRP1 antibody, DKFZp781G125 antibody, Cftr/Mrp 1 antibody, DKFZp686N04233 antibody, ABCC antibody, Atp-Binding Cassette Sub-Family C1 antibody, MRP antibody, ABC29 antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen ABCC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYGA
Assay Information ABCC1 Blocking Peptide, catalog no. 33R-4941, is also available for use as a blocking control in assays to test for specificity of this ABCC1 antibody

Images

Western Blot analysis using ABCC1 antibody (70R-6981)

ABCC1 antibody (70R-6981) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 171 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABCC1 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABCC1 antibody (70R-6981) | ABCC1 antibody (70R-6981) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors