ABCC11 antibody (70R-6719)

Rabbit polyclonal ABCC11 antibody

Synonyms Polyclonal ABCC11 antibody, Anti-ABCC11 antibody, Cftr/Mrp 11 antibody, Atp-Binding Cassette Sub-Family C11 antibody, EWWD antibody, WW antibody, MRP8 antibody
Cross Reactivity Human
Applications WB
Immunogen ABCC11 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSKIILIDEATASIDMETDTLIQRTIREAFQGCTVLVIAHRVTTVLNCDH
Assay Information ABCC11 Blocking Peptide, catalog no. 33R-6880, is also available for use as a blocking control in assays to test for specificity of this ABCC11 antibody


Western Blot analysis using ABCC11 antibody (70R-6719)

ABCC11 antibody (70R-6719) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 154 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCC11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ABCC11 antibody (70R-6719) | ABCC11 antibody (70R-6719) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors