ABCC3 antibody (70R-6716)

Rabbit polyclonal ABCC3 antibody

Synonyms Polyclonal ABCC3 antibody, Anti-ABCC3 antibody, MRP3 antibody, EST90757 antibody, MOAT-D antibody, ABC31 antibody, Cftr/Mrp 3 antibody, cMOAT2 antibody, Atp-Binding Cassette Sub-Family C3 antibody, MLP2 antibody
Cross Reactivity Human
Applications WB
Immunogen ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL
Assay Information ABCC3 Blocking Peptide, catalog no. 33R-4707, is also available for use as a blocking control in assays to test for specificity of this ABCC3 antibody

Images

Western Blot analysis using ABCC3 antibody (70R-6716)

ABCC3 antibody (70R-6716) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 168 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABCC3 antibody (70R-6716) | ABCC3 antibody (70R-6716) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors