ABCC8 antibody (70R-6686)

Rabbit polyclonal ABCC8 antibody

Synonyms Polyclonal ABCC8 antibody, Anti-ABCC8 antibody, Cftr/Mrp 8 antibody, Atp-Binding Cassette Sub-Family C8 antibody, SUR1 antibody, ABC36 antibody, MRP8 antibody, HRINS antibody, TNDM2 antibody, HHF1 antibody, HI antibody, PHHI antibody, SUR antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
Assay Information ABCC8 Blocking Peptide, catalog no. 33R-7184, is also available for use as a blocking control in assays to test for specificity of this ABCC8 antibody


Western blot analysis using ABCC8 antibody (70R-6686)

Recommended ABCC8 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 177 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCC8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using ABCC8 antibody (70R-6686) | Recommended ABCC8 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using ABCC8 antibody (70R-6686) | Small intestine

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors