ABCC9 antibody (70R-6250)

Rabbit polyclonal ABCC9 antibody

Synonyms Polyclonal ABCC9 antibody, Anti-ABCC9 antibody, Atp-Binding Cassette Sub-Family C9 antibody, FLJ36852 antibody, CMD1O antibody, ABC37 antibody, SUR2 antibody, Cftr/Mrp 9 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ABCC9 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVVTEGGENFSVGQRQLFCLARAFVRKSSILIMDEATASIDMATENILQK
Assay Information ABCC9 Blocking Peptide, catalog no. 33R-1620, is also available for use as a blocking control in assays to test for specificity of this ABCC9 antibody

Images

Western Blot analysis using ABCC9 antibody (70R-6250)

ABCC9 antibody (70R-6250) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 174 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCC9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABCC9 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein is thought to form ATP-sensitive potassium channels in cardiac, skeletal, and vascular and non-vascular smooth muscle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABCC9 antibody (70R-6250) | ABCC9 antibody (70R-6250) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors