ABCD3 antibody (70R-7348)

Rabbit polyclonal ABCD3 antibody

Synonyms Polyclonal ABCD3 antibody, Anti-ABCD3 antibody, PXMP1 antibody, Atp-Binding Cassette Sub-Family D3 antibody, Ald3 antibody, PMP70 antibody, ABC43 antibody
Cross Reactivity Human
Applications WB
Immunogen ABCD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKYGLNELKLCFRVRLTKYLYEEYLQAFTYYKMGNLDNRIANPDQLLTQD
Assay Information ABCD3 Blocking Peptide, catalog no. 33R-5113, is also available for use as a blocking control in assays to test for specificity of this ABCD3 antibody

Images

Western Blot analysis using ABCD3 antibody (70R-7348)

ABCD3 antibody (70R-7348) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABCD3 antibody (70R-7348) | ABCD3 antibody (70R-7348) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors