ABCF2 antibody (70R-5704)

Rabbit polyclonal ABCF2 antibody

Synonyms Polyclonal ABCF2 antibody, Anti-ABCF2 antibody, Atp-Binding Cassette Sub-Family F3 antibody, Gcn20 2 antibody, HUSSY-18 antibody, EST133090 antibody, ABC28 antibody, M-ABC1 antibody, DKFZp586K1823 antibody
Cross Reactivity Human
Applications WB
Immunogen ABCF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMEL
Assay Information ABCF2 Blocking Peptide, catalog no. 33R-2013, is also available for use as a blocking control in assays to test for specificity of this ABCF2 antibody


Western Blot analysis using ABCF2 antibody (70R-5704)

ABCF2 antibody (70R-5704) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABCF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ABCF2 antibody (70R-5704) | ABCF2 antibody (70R-5704) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors