ABHD12 antibody (70R-6784)

Rabbit polyclonal ABHD12 antibody raised against the middle region of ABHD12

Synonyms Polyclonal ABHD12 antibody, Anti-ABHD12 antibody, ABHD12A antibody, Abhydrolase Domain Containing 12 antibody, C20orf22 antibody, DKFZP434P106 antibody, BEM46L2 antibody, dJ965G21.2 antibody
Specificity ABHD12 antibody was raised against the middle region of ABHD12
Cross Reactivity Human
Applications WB
Immunogen ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH
Assay Information ABHD12 Blocking Peptide, catalog no. 33R-1766, is also available for use as a blocking control in assays to test for specificity of this ABHD12 antibody

Images

Western Blot analysis using ABHD12 antibody (70R-6784)

ABHD12 antibody (70R-6784) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABHD12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ABHD12 may be a regulator of endocannabinoid signaling pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ABHD12 antibody (70R-6784) | ABHD12 antibody (70R-6784) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors