ABHD7 antibody (70R-7489)

Rabbit polyclonal ABHD7 antibody raised against the N terminal of ABHD7

Synonyms Polyclonal ABHD7 antibody, Anti-ABHD7 antibody, Abhydrolase Domain Containing 7 antibody, EPHXRP antibody, FLJ90341 antibody
Specificity ABHD7 antibody was raised against the N terminal of ABHD7
Cross Reactivity Human,Mouse
Applications WB
Immunogen ABHD7 antibody was raised using the N terminal of ABHD7 corresponding to a region with amino acids HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY
Assay Information ABHD7 Blocking Peptide, catalog no. 33R-3705, is also available for use as a blocking control in assays to test for specificity of this ABHD7 antibody

Images

Western blot analysis using ABHD7 antibody (70R-7489)

Recommended ABHD7 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ABHD7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of ABHD7 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using ABHD7 antibody (70R-7489) | Recommended ABHD7 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors