ACAT1 antibody (70R-2468)

Rabbit polyclonal ACAT1 antibody raised against the middle region of ACAT1

Synonyms Polyclonal ACAT1 antibody, Anti-ACAT1 antibody, ACAT 1, ACAT antibody, Acetyl-Coenzyme A Acetyltransferase 1 antibody, T2 antibody, ACAT 1 antibody, ACAT1, THIL antibody, ACAT-1, MAT antibody, ACAT-1 antibody
Specificity ACAT1 antibody was raised against the middle region of ACAT1
Cross Reactivity Human
Applications WB
Immunogen ACAT1 antibody was raised using the middle region of ACAT1 corresponding to a region with amino acids GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH
Assay Information ACAT1 Blocking Peptide, catalog no. 33R-3310, is also available for use as a blocking control in assays to test for specificity of this ACAT1 antibody


Immunohistochemical staining using ACAT1 antibody (70R-2468)

ACAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACAT1 is a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. The gene encoding ACAT1 spans approximately 27 kb and contains 12 exons interrupted by 11 introns. Defects in this gene are associated with the alpha-methylacetoaceticaciduria disorder, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using ACAT1 antibody (70R-2468) | ACAT1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ACAT1 antibody (70R-2468) | ACAT1 antibody (70R-2468) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors