ACBD4 antibody (70R-6742)

Rabbit polyclonal ACBD4 antibody raised against the N terminal of ACBD4

Synonyms Polyclonal ACBD4 antibody, Anti-ACBD4 antibody, ACBD-4 antibody, FLJ13322 antibody, Acyl-Coenzyme A Binding Domain Containing 4 antibody, FLJ90623 antibody, HMFT0700 antibody, ACBD4, ACBD 4 antibody, ACBD 4, ACBD-4
Specificity ACBD4 antibody was raised against the N terminal of ACBD4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
Assay Information ACBD4 Blocking Peptide, catalog no. 33R-6881, is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody

Images

Western Blot analysis using ACBD4 antibody (70R-6742)

ACBD4 antibody (70R-6742) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACBD4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACBD4 antibody (70R-6742) | ACBD4 antibody (70R-6742) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors