ACBD5 antibody (70R-6732)

Rabbit polyclonal ACBD5 antibody raised against the C terminal of ACBD5

Synonyms Polyclonal ACBD5 antibody, Anti-ACBD5 antibody, DKFZp434A2417 antibody, ACBD 5 antibody, Acyl-Coenzyme A Binding Domain Containing 5 antibody, ACBD-5 antibody, ACBD5, ACBD 5, ACBD-5, KIAA1996 antibody
Specificity ACBD5 antibody was raised against the C terminal of ACBD5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ACBD5 antibody was raised using the C terminal of ACBD5 corresponding to a region with amino acids VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR
Assay Information ACBD5 Blocking Peptide, catalog no. 33R-9785, is also available for use as a blocking control in assays to test for specificity of this ACBD5 antibody

Images

Western Blot analysis using ACBD5 antibody (70R-6732)

ACBD5 antibody (70R-6732) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACBD5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACBD5 antibody (70R-6732) | ACBD5 antibody (70R-6732) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors