ACBD7 antibody (70R-3468)

Rabbit polyclonal ACBD7 antibody raised against the N terminal of ACBD7

Synonyms Polyclonal ACBD7 antibody, Anti-ACBD7 antibody, bA455B2.2 antibody, ACBD7, MGC33893 antibody, ACBD 7, ACBD-7, ACBD-7 antibody, Acyl-Coenzyme A Binding Domain Containing 7 antibody, FLJ38219 antibody, ACBD 7 antibody
Specificity ACBD7 antibody was raised against the N terminal of ACBD7
Cross Reactivity Human
Applications WB
Immunogen ACBD7 antibody was raised using the N terminal of ACBD7 corresponding to a region with amino acids MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLD
Assay Information ACBD7 Blocking Peptide, catalog no. 33R-5696, is also available for use as a blocking control in assays to test for specificity of this ACBD7 antibody


Western Blot analysis using ACBD7 antibody (70R-3468)

ACBD7 antibody (70R-3468) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACBD7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ACBD7 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ACBD7 antibody (70R-3468) | ACBD7 antibody (70R-3468) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors