ACCN1 antibody (70R-5101)

Rabbit polyclonal ACCN1 antibody

Synonyms Polyclonal ACCN1 antibody, Anti-ACCN1 antibody, ASIC2 antibody, ACCN-1 antibody, ACCN antibody, ASIC2a antibody, ACCN 1 antibody, ACCN1, BNaC1 antibody, Amiloride-Sensitive Cation Channel 1 Neuronal antibody, Degenerin antibody, ACCN 1, ACCN-1, MDEG antibody, hBNaC1 antibody, BNC1 antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
Assay Information ACCN1 Blocking Peptide, catalog no. 33R-3197, is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody

Images

Western Blot analysis using ACCN1 antibody (70R-5101)

ACCN1 antibody (70R-5101) used at 2 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ACCN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ACCN1 antibody (70R-5101) | ACCN1 antibody (70R-5101) used at 2 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors